Sorex araneus (European shrew): 101557733 Help Entry 101557733         CDS       T07854                                  Symbol H3F3B Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism sara  Sorex araneus (European shrew) Pathway sara04613   Neutrophil extracellular trap formation sara05034   Alcoholism sara05202   Transcriptional misregulation in cancer sara05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:sara00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101557733 (H3F3B)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101557733 (H3F3B)   09163 Immune disease    05322 Systemic lupus erythematosus     101557733 (H3F3B)   09165 Substance dependence    05034 Alcoholism     101557733 (H3F3B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sara03036]     101557733 (H3F3B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sara04147]     101557733 (H3F3B) Chromosome and associated proteins [BR:sara03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101557733 (H3F3B) Exosome [BR:sara04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101557733 (H3F3B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  101557733 NCBI-ProteinID:  XP_004615767 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MVPTSALKYPSVVHTLDLQPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLR FQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggttcccacgtcagccctcaaatacccgagtgtggtccatacactagaccttcagccc ggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgagctgctgatccgc aagctgccgttccagcggctggtgcgggagatcgcgcaggacttcaagacggacctgcgg ttccagagcgccgccatcggggcgctgcaggaggcgagcgaagcgtacctggtggggctg ttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatcatgcccaaggac atccagctggcccgccggatacggggggagcgggcctag

DBGET integrated database retrieval system