KEGG   Sorex araneus (European shrew): 101559341
Entry
101559341         CDS       T07854                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sara  Sorex araneus (European shrew)
Pathway
sara01521  EGFR tyrosine kinase inhibitor resistance
sara01522  Endocrine resistance
sara01524  Platinum drug resistance
sara04010  MAPK signaling pathway
sara04012  ErbB signaling pathway
sara04014  Ras signaling pathway
sara04015  Rap1 signaling pathway
sara04022  cGMP-PKG signaling pathway
sara04024  cAMP signaling pathway
sara04062  Chemokine signaling pathway
sara04066  HIF-1 signaling pathway
sara04068  FoxO signaling pathway
sara04071  Sphingolipid signaling pathway
sara04072  Phospholipase D signaling pathway
sara04114  Oocyte meiosis
sara04140  Autophagy - animal
sara04148  Efferocytosis
sara04150  mTOR signaling pathway
sara04151  PI3K-Akt signaling pathway
sara04210  Apoptosis
sara04218  Cellular senescence
sara04261  Adrenergic signaling in cardiomyocytes
sara04270  Vascular smooth muscle contraction
sara04350  TGF-beta signaling pathway
sara04360  Axon guidance
sara04370  VEGF signaling pathway
sara04371  Apelin signaling pathway
sara04380  Osteoclast differentiation
sara04510  Focal adhesion
sara04520  Adherens junction
sara04540  Gap junction
sara04550  Signaling pathways regulating pluripotency of stem cells
sara04611  Platelet activation
sara04613  Neutrophil extracellular trap formation
sara04620  Toll-like receptor signaling pathway
sara04621  NOD-like receptor signaling pathway
sara04625  C-type lectin receptor signaling pathway
sara04650  Natural killer cell mediated cytotoxicity
sara04657  IL-17 signaling pathway
sara04658  Th1 and Th2 cell differentiation
sara04659  Th17 cell differentiation
sara04660  T cell receptor signaling pathway
sara04662  B cell receptor signaling pathway
sara04664  Fc epsilon RI signaling pathway
sara04666  Fc gamma R-mediated phagocytosis
sara04668  TNF signaling pathway
sara04713  Circadian entrainment
sara04720  Long-term potentiation
sara04722  Neurotrophin signaling pathway
sara04723  Retrograde endocannabinoid signaling
sara04724  Glutamatergic synapse
sara04725  Cholinergic synapse
sara04726  Serotonergic synapse
sara04730  Long-term depression
sara04810  Regulation of actin cytoskeleton
sara04910  Insulin signaling pathway
sara04912  GnRH signaling pathway
sara04914  Progesterone-mediated oocyte maturation
sara04915  Estrogen signaling pathway
sara04916  Melanogenesis
sara04917  Prolactin signaling pathway
sara04919  Thyroid hormone signaling pathway
sara04921  Oxytocin signaling pathway
sara04926  Relaxin signaling pathway
sara04928  Parathyroid hormone synthesis, secretion and action
sara04929  GnRH secretion
sara04930  Type II diabetes mellitus
sara04933  AGE-RAGE signaling pathway in diabetic complications
sara04934  Cushing syndrome
sara04935  Growth hormone synthesis, secretion and action
sara04960  Aldosterone-regulated sodium reabsorption
sara05010  Alzheimer disease
sara05020  Prion disease
sara05022  Pathways of neurodegeneration - multiple diseases
sara05034  Alcoholism
sara05132  Salmonella infection
sara05133  Pertussis
sara05135  Yersinia infection
sara05140  Leishmaniasis
sara05142  Chagas disease
sara05145  Toxoplasmosis
sara05152  Tuberculosis
sara05160  Hepatitis C
sara05161  Hepatitis B
sara05163  Human cytomegalovirus infection
sara05164  Influenza A
sara05165  Human papillomavirus infection
sara05166  Human T-cell leukemia virus 1 infection
sara05167  Kaposi sarcoma-associated herpesvirus infection
sara05170  Human immunodeficiency virus 1 infection
sara05171  Coronavirus disease - COVID-19
sara05200  Pathways in cancer
sara05203  Viral carcinogenesis
sara05205  Proteoglycans in cancer
sara05206  MicroRNAs in cancer
sara05207  Chemical carcinogenesis - receptor activation
sara05208  Chemical carcinogenesis - reactive oxygen species
sara05210  Colorectal cancer
sara05211  Renal cell carcinoma
sara05212  Pancreatic cancer
sara05213  Endometrial cancer
sara05214  Glioma
sara05215  Prostate cancer
sara05216  Thyroid cancer
sara05218  Melanoma
sara05219  Bladder cancer
sara05220  Chronic myeloid leukemia
sara05221  Acute myeloid leukemia
sara05223  Non-small cell lung cancer
sara05224  Breast cancer
sara05225  Hepatocellular carcinoma
sara05226  Gastric cancer
sara05230  Central carbon metabolism in cancer
sara05231  Choline metabolism in cancer
sara05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
sara05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:sara00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101559341 (MAPK3)
   04012 ErbB signaling pathway
    101559341 (MAPK3)
   04014 Ras signaling pathway
    101559341 (MAPK3)
   04015 Rap1 signaling pathway
    101559341 (MAPK3)
   04350 TGF-beta signaling pathway
    101559341 (MAPK3)
   04370 VEGF signaling pathway
    101559341 (MAPK3)
   04371 Apelin signaling pathway
    101559341 (MAPK3)
   04668 TNF signaling pathway
    101559341 (MAPK3)
   04066 HIF-1 signaling pathway
    101559341 (MAPK3)
   04068 FoxO signaling pathway
    101559341 (MAPK3)
   04072 Phospholipase D signaling pathway
    101559341 (MAPK3)
   04071 Sphingolipid signaling pathway
    101559341 (MAPK3)
   04024 cAMP signaling pathway
    101559341 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101559341 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101559341 (MAPK3)
   04150 mTOR signaling pathway
    101559341 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101559341 (MAPK3)
   04148 Efferocytosis
    101559341 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101559341 (MAPK3)
   04210 Apoptosis
    101559341 (MAPK3)
   04218 Cellular senescence
    101559341 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101559341 (MAPK3)
   04520 Adherens junction
    101559341 (MAPK3)
   04540 Gap junction
    101559341 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101559341 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101559341 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101559341 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101559341 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101559341 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101559341 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101559341 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101559341 (MAPK3)
   04660 T cell receptor signaling pathway
    101559341 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101559341 (MAPK3)
   04659 Th17 cell differentiation
    101559341 (MAPK3)
   04657 IL-17 signaling pathway
    101559341 (MAPK3)
   04662 B cell receptor signaling pathway
    101559341 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101559341 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101559341 (MAPK3)
   04062 Chemokine signaling pathway
    101559341 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101559341 (MAPK3)
   04929 GnRH secretion
    101559341 (MAPK3)
   04912 GnRH signaling pathway
    101559341 (MAPK3)
   04915 Estrogen signaling pathway
    101559341 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101559341 (MAPK3)
   04917 Prolactin signaling pathway
    101559341 (MAPK3)
   04921 Oxytocin signaling pathway
    101559341 (MAPK3)
   04926 Relaxin signaling pathway
    101559341 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101559341 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101559341 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101559341 (MAPK3)
   04916 Melanogenesis
    101559341 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101559341 (MAPK3)
   04270 Vascular smooth muscle contraction
    101559341 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101559341 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101559341 (MAPK3)
   04725 Cholinergic synapse
    101559341 (MAPK3)
   04726 Serotonergic synapse
    101559341 (MAPK3)
   04720 Long-term potentiation
    101559341 (MAPK3)
   04730 Long-term depression
    101559341 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101559341 (MAPK3)
   04722 Neurotrophin signaling pathway
    101559341 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101559341 (MAPK3)
   04380 Osteoclast differentiation
    101559341 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101559341 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101559341 (MAPK3)
   05206 MicroRNAs in cancer
    101559341 (MAPK3)
   05205 Proteoglycans in cancer
    101559341 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101559341 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101559341 (MAPK3)
   05203 Viral carcinogenesis
    101559341 (MAPK3)
   05230 Central carbon metabolism in cancer
    101559341 (MAPK3)
   05231 Choline metabolism in cancer
    101559341 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101559341 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101559341 (MAPK3)
   05212 Pancreatic cancer
    101559341 (MAPK3)
   05225 Hepatocellular carcinoma
    101559341 (MAPK3)
   05226 Gastric cancer
    101559341 (MAPK3)
   05214 Glioma
    101559341 (MAPK3)
   05216 Thyroid cancer
    101559341 (MAPK3)
   05221 Acute myeloid leukemia
    101559341 (MAPK3)
   05220 Chronic myeloid leukemia
    101559341 (MAPK3)
   05218 Melanoma
    101559341 (MAPK3)
   05211 Renal cell carcinoma
    101559341 (MAPK3)
   05219 Bladder cancer
    101559341 (MAPK3)
   05215 Prostate cancer
    101559341 (MAPK3)
   05213 Endometrial cancer
    101559341 (MAPK3)
   05224 Breast cancer
    101559341 (MAPK3)
   05223 Non-small cell lung cancer
    101559341 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101559341 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101559341 (MAPK3)
   05161 Hepatitis B
    101559341 (MAPK3)
   05160 Hepatitis C
    101559341 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101559341 (MAPK3)
   05164 Influenza A
    101559341 (MAPK3)
   05163 Human cytomegalovirus infection
    101559341 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101559341 (MAPK3)
   05165 Human papillomavirus infection
    101559341 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101559341 (MAPK3)
   05135 Yersinia infection
    101559341 (MAPK3)
   05133 Pertussis
    101559341 (MAPK3)
   05152 Tuberculosis
    101559341 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101559341 (MAPK3)
   05140 Leishmaniasis
    101559341 (MAPK3)
   05142 Chagas disease
    101559341 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101559341 (MAPK3)
   05020 Prion disease
    101559341 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101559341 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101559341 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101559341 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101559341 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101559341 (MAPK3)
   04934 Cushing syndrome
    101559341 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101559341 (MAPK3)
   01524 Platinum drug resistance
    101559341 (MAPK3)
   01522 Endocrine resistance
    101559341 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sara01001]
    101559341 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sara03036]
    101559341 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sara04147]
    101559341 (MAPK3)
Enzymes [BR:sara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101559341 (MAPK3)
Protein kinases [BR:sara01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101559341 (MAPK3)
Chromosome and associated proteins [BR:sara03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101559341 (MAPK3)
Exosome [BR:sara04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101559341 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101559341
NCBI-ProteinID: XP_004615902
LinkDB
Position
Unknown
AA seq 325 aa
MVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEA
MRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAK
LFPKADSKALDLLDRMLTFNPNKRITVEEALAHPYVDQYYDPTDEPVAEEPFTFDMELDD
LPKEQLKELIFQETAPFQPGALETP
NT seq 978 nt   +upstreamnt  +downstreamnt
atggtcagctcagcttacgaccatgtgcgcaagacgcgagtggccatcaagaaaatcagt
cccttcgagcatcagacctactgtcagcgcacgctgcgagagattcagatcttgctgcgc
ttccgccacgagaatgtcatcggcatccgggacatcctgcgggcccccaccctggaagcc
atgcgggatgtctatattgtgcaggacctgatggagacagacctgtacaagttgctcaaa
agccagcagctgagcaacgaccatatctgctacttcctgtaccagatcctgcggggcctc
aagtacatccactcggccaatgtgctccaccgggacttaaagccctccaacctgctcatc
aacaccacctgcgaccttaagatctgcgactttggcctggcccggattgccgatcctgag
cacgaccacacgggcttcctaacagaatacgtggcgacacgctggtaccgggccccagag
atcatgctgaattccaagggctataccaagtccattgacatctggtctgtgggctgtatc
ttggccgagatgctctccaaccggcccatcttccctggcaagcactacttagaccagctc
aaccacattctgggtatcctgggctcaccatcgcaggaggacctgaattgtatcatcaac
atgaaggcccggaactacctacagtctcttccctccaagaccaaagtggcctgggccaag
ctttttcccaaggcagactccaaagcccttgacctgctggaccggatgttgacctttaac
cccaacaaacggatcacggtggaggaagctctggctcatccctatgtggaccagtactat
gacccgacggatgagcccgtggccgaggagcctttcacctttgacatggagctggatgac
ctacccaaggagcagctgaaggagctcatcttccaggaaacagccccctttcagccggga
gccctggagaccccttaa

DBGET integrated database retrieval system