Sorex araneus (European shrew): 101559441 Help Entry 101559441         CDS       T07854                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism sara  Sorex araneus (European shrew) Pathway sara04060   Cytokine-cytokine receptor interaction sara04061   Viral protein interaction with cytokine and cytokine receptor sara04062   Chemokine signaling pathway sara04064   NF-kappa B signaling pathway sara04072   Phospholipase D signaling pathway sara04218   Cellular senescence sara04620   Toll-like receptor signaling pathway sara04621   NOD-like receptor signaling pathway sara04622   RIG-I-like receptor signaling pathway sara04657   IL-17 signaling pathway sara04932   Non-alcoholic fatty liver disease sara04933   AGE-RAGE signaling pathway in diabetic complications sara04936   Alcoholic liver disease sara05132   Salmonella infection sara05133   Pertussis sara05134   Legionellosis sara05135   Yersinia infection sara05142   Chagas disease sara05144   Malaria sara05146   Amoebiasis sara05161   Hepatitis B sara05163   Human cytomegalovirus infection sara05164   Influenza A sara05167   Kaposi sarcoma-associated herpesvirus infection sara05171   Coronavirus disease - COVID-19 sara05200   Pathways in cancer sara05202   Transcriptional misregulation in cancer sara05219   Bladder cancer sara05323   Rheumatoid arthritis sara05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:sara00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101559441 (CXCL8)    04072 Phospholipase D signaling pathway     101559441 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101559441 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     101559441 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     101559441 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101559441 (CXCL8)    04621 NOD-like receptor signaling pathway     101559441 (CXCL8)    04622 RIG-I-like receptor signaling pathway     101559441 (CXCL8)    04657 IL-17 signaling pathway     101559441 (CXCL8)    04062 Chemokine signaling pathway     101559441 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101559441 (CXCL8)    05202 Transcriptional misregulation in cancer     101559441 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     101559441 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     101559441 (CXCL8)    05171 Coronavirus disease - COVID-19     101559441 (CXCL8)    05164 Influenza A     101559441 (CXCL8)    05163 Human cytomegalovirus infection     101559441 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     101559441 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     101559441 (CXCL8)    05135 Yersinia infection     101559441 (CXCL8)    05133 Pertussis     101559441 (CXCL8)    05134 Legionellosis     101559441 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     101559441 (CXCL8)    05144 Malaria     101559441 (CXCL8)    05142 Chagas disease     101559441 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     101559441 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101559441 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101559441 (CXCL8)    04932 Non-alcoholic fatty liver disease     101559441 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     101559441 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sara04052]     101559441 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:sara00536]     101559441 (CXCL8) Cytokines and neuropeptides [BR:sara04052]  Cytokines   Chemokines    101559441 (CXCL8) Glycosaminoglycan binding proteins [BR:sara00536]  Heparan sulfate / Heparin   Chemokines    101559441 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 YMR265C_C CXCL16 Motif Other DBs NCBI-GeneID:  101559441 NCBI-ProteinID:  XP_004617929 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTAKLIAGLLAAFLLSSVLCEDAVVLRFNAELRCQCIDTHSKPFHPKYIKELRVIESGPH CPHSEIIVILTSNKEVCLDPKEKWVQRVAQKFLKRAEKEEP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgactgccaaactgattgctgggcttctggcagctttcctgctctcttcagttctgtgt gaagatgcagtagttttaagatttaatgcagaacttcgatgccagtgcatagacactcac tctaagcctttccatcccaaatacatcaaagagctgcgggtgatcgagagtggacctcac tgcccacattcagaaatcattgtaattctcacctcaaataaagaagtctgcctggatcct aaggaaaagtgggtgcagagggttgcacagaaatttttgaagagagctgaaaaggaagag ccataa

DBGET integrated database retrieval system