Sorex araneus (European shrew): 105943016 Help Entry 105943016         CDS       T07854                                  Name (RefSeq) metallothionein-2A-like   KO K14739   metallothionein 1/2 Organism sara  Sorex araneus (European shrew) Pathway sara04978   Mineral absorption Brite KEGG Orthology (KO) [BR:sara00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105943016  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sara03019]     105943016    03029 Mitochondrial biogenesis [BR:sara03029]     105943016 Messenger RNA biogenesis [BR:sara03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105943016 Mitochondrial biogenesis [BR:sara03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105943016 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105943016 NCBI-ProteinID:  XP_012788277 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MDPNCSGCAGGACSCADSCKCKDCKCGFCKKSCCSCCPAGCAKCAQGCVCKGAPSDKCSC CA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctccggctgcgctggcggcgcctgcagctgcgcggactcctgcaag tgcaaagactgcaaatgcggcttctgcaagaagagctgctgctcctgctgccccgcgggc tgtgccaagtgtgcccagggctgtgtgtgcaaaggggcaccgtcggacaagtgcagctgc tgcgcctga

DBGET integrated database retrieval system