Stenotrophomonas aracearum: PDM28_15340 Help Entry PDM28_15340       CDS       T10111                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism sarc  Stenotrophomonas aracearum Brite KEGG Orthology (KO) [BR:sarc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sarc03036]     PDM28_15340 Chromosome and associated proteins [BR:sarc03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PDM28_15340 SSDB OrthologParalogGFIT Motif Pfam:  ZapB SPC25_N Taxilin Dynamitin Stathmin Rab11-FIP3 YabA ZapB_rel Mod_r bZIP_1 DUF8429 XRCC4_CC T4SS_LegC2C7 GIT_CC DUF3450 FAZ1_C UPF0449 NRBF2 Nup88 Motif Other DBs NCBI-ProteinID:  WNH48037 UniProt:  A0ABY9YBF9 LinkDB All DBs Position 3394226..3394447 Genome browser AA seq 73 aa AA seqDB search MEPSDAIAQLQAFAARVEALLERNQRLAEENRSLRHQQETLVNERSQLLAKNEQARSRVE AMITRLKSLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaaccttccgatgccatcgcccagttgcaggcctttgccgcccgggtagaggcgttg ctggagcgcaaccagcgcctggccgaggagaaccgcagcctgcgccaccagcaggagacg ctggtcaacgagcgctcgcagctgctggccaagaacgagcaggcccgctcccgggtggaa gcgatgatcacccggctcaaatcgctggagcagcacacatga

DBGET integrated database retrieval system