Stenotrophomonas aracearum: PDM28_18640 Help Entry PDM28_18640       CDS       T10111                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sarc  Stenotrophomonas aracearum Pathway sarc01100   Metabolic pathways sarc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sarc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PDM28_18640    00074 Mycolic acid biosynthesis     PDM28_18640   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PDM28_18640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WNH48649 UniProt:  A0ABY9YCP2 LinkDB All DBs Position complement(4162587..4162844) Genome browser AA seq 85 aa AA seqDB search MTKNALFDRIVKILKDSFEIEPVRITPQARLYDDLDIDSIDAVDLIVQLKPLLGRNLQPE AFKSVRTVQDIVDVVHGLLPGQAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccaagaacgcacttttcgatcgcatcgtcaagatcctcaaggacagctttgagatc gaaccggtgcgcatcaccccgcaggcccgcctgtacgacgacctggacatcgacagcatc gacgcggtcgacctgatcgtgcagctcaagccactgctgggtcgcaacctgcaacctgaa gcgttcaagtcggtacgcaccgtccaggacatcgtcgatgtcgtgcacggcttgctgccc gggcaagcggccgcctga

DBGET integrated database retrieval system