Streptomyces argyrophylli: HKX69_24010 Help Entry HKX69_24010       CDS       T09378                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sarg  Streptomyces argyrophylli Pathway sarg00998   Biosynthesis of various antibiotics sarg01100   Metabolic pathways sarg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sarg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HKX69_24010    00074 Mycolic acid biosynthesis     HKX69_24010   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HKX69_24010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QJS12172 UniProt:  A0A6M4PMN7 LinkDB All DBs Position complement(5377782..5378030) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgcgggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system