Sphingomonas aliaeris: H5J25_04515 Help Entry H5J25_04515       CDS       T07559                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sari  Sphingomonas aliaeris Brite KEGG Orthology (KO) [BR:sari00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sari03032]     H5J25_04515    03036 Chromosome and associated proteins [BR:sari03036]     H5J25_04515    03400 DNA repair and recombination proteins [BR:sari03400]     H5J25_04515 DNA replication proteins [BR:sari03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     H5J25_04515 Chromosome and associated proteins [BR:sari03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     H5J25_04515 DNA repair and recombination proteins [BR:sari03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       H5J25_04515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QQV78009 UniProt:  A0A974S4Z2 LinkDB All DBs Position complement(1005997..1006266) Genome browser AA seq 89 aa AA seqDB search MNIGELVKGVAGATGSNEAEAKAAITAVFDQIAVAAAKGDDVSIPGFGKFAVKDRPERQG RNPASGAAITIAASKKVTFTAAKGLKDKL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaatatcggcgaactggtcaagggtgtggcgggagcaaccgggtcgaacgaggcggag gcgaaggctgccatcacggcggtcttcgatcagatcgccgtcgcggcggccaagggcgac gatgtttctatcccggggtttggcaagttcgcggtcaaggatcggcctgaacgacagggt cgtaatcctgctagcggcgcagcgatcacgatcgctgcctccaagaaggtcaccttcacc gccgccaaaggcctgaaggacaagctctga

DBGET integrated database retrieval system