Sphingomonas aliaeris: H5J25_06575 Help Entry H5J25_06575       CDS       T07559                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sari  Sphingomonas aliaeris Pathway sari01100   Metabolic pathways sari01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sari00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H5J25_06575    00074 Mycolic acid biosynthesis     H5J25_06575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H5J25_06575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Thoc2 Motif Other DBs NCBI-ProteinID:  QQV78327 UniProt:  A0A974S554 LinkDB All DBs Position complement(1414622..1414864) Genome browser AA seq 80 aa AA seqDB search MTDRTAIFDTVAAQIEPFDKKGVEITDATTFQGNLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETVGQLVDAVAKLKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccgcaccgccatcttcgacaccgtcgccgcccagatcgaacccttcgacaag aagggcgtcgagattaccgatgctaccacgttccagggcaatctggaatgggacagcctg accgtgatggatttcgtcgctgcgatcgaagacgagttcgacattatcataacgatgaac atgcaggcggagatcgaaacggtcggccagttggtcgatgcggtcgccaagctgaagggt tga

DBGET integrated database retrieval system