Sphingomonas aliaeris: H5J25_10005 Help Entry H5J25_10005       CDS       T07559                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sari  Sphingomonas aliaeris Pathway sari01100   Metabolic pathways sari01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sari00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H5J25_10005    00074 Mycolic acid biosynthesis     H5J25_10005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H5J25_10005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QQV75932 UniProt:  A0A974NS54 LinkDB All DBs Position complement(2115756..2115992) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITFIDEHKD NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgcagaccgcgttaagaagattgtcgtcgaacatctcggcgtcgaagcc gataaggtaaccgaggacgccagcttcatcgacgatctgggcgcggacagcctcgacatc gtcgagctggttatggcgttcgaggaagaattcggcgtcgagatccccgatgatgccgcc gagaagatcacgaccgtcaaggacgcgatcaccttcatcgacgagcacaaggactga

DBGET integrated database retrieval system