Sphingomonas aliaeris: H5J25_18150 Help Entry H5J25_18150       CDS       T07559                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism sari  Sphingomonas aliaeris Pathway sari00030   Pentose phosphate pathway sari00051   Fructose and mannose metabolism sari00710   Carbon fixation by Calvin cycle sari01100   Metabolic pathways sari01110   Biosynthesis of secondary metabolites sari01120   Microbial metabolism in diverse environments sari01200   Carbon metabolism sari01230   Biosynthesis of amino acids Module sari_M00004   Pentose phosphate pathway (Pentose phosphate cycle) sari_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:sari00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     H5J25_18150 (rpiB)    00051 Fructose and mannose metabolism     H5J25_18150 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     H5J25_18150 (rpiB) Enzymes [BR:sari01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      H5J25_18150 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  QQV77213 UniProt:  A0A974NUU9 LinkDB All DBs Position 3825318..3825770 Genome browser AA seq 150 aa AA seqDB search MRIAIASDHAAFNLKAVLAAWLAGQGHDIVDLGPDSTDRVDYPDFGYRLANTVAAGDADR GVALCGSGIGISIAVNRNPAIRCALVGEPLSAALAREHNDANVIAMGARLTGEDMAKVCI TAFLTTDFAGGRHSARVDKLSHPQFEELPA NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgcgcatcgccatcgcatccgatcacgccgctttcaatttgaaggcggttctcgcagct tggctggcggggcaggggcatgacatcgtcgatcttggccccgacagcacggaccgcgtc gactaccccgatttcggataccggcttgcgaataccgtagcggcaggggacgccgatcgc ggcgttgccttgtgcgggtcgggcatcggtatctcgatcgcggtcaaccgcaaccccgcg atccgttgcgcgctggtgggcgagccgttgtccgcggcgcttgcgcgcgagcataacgat gccaacgtcatcgcgatgggcgcccgcctgaccggcgaggacatggcgaaggtctgcatc accgcttttctgaccaccgattttgccggcggccgccattcggcgcgcgtcgataaattg agccatccgcagttcgaggagcttccagcatga

DBGET integrated database retrieval system