Staphylococcus arlettae: SAP2_16120 Help Entry SAP2_16120        CDS       T06808                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sarl  Staphylococcus arlettae Pathway sarl00998   Biosynthesis of various antibiotics sarl01100   Metabolic pathways sarl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sarl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAP2_16120 (acpP)    00074 Mycolic acid biosynthesis     SAP2_16120 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAP2_16120 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BBK28428 LinkDB All DBs Position complement(1688620..1688853) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTAEASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaagatatcatcgttgaccgtttaggtgtagatgctgac aaagttactgctgaagcatcatttaaagacgatttaggcgctgactcacttgatattgct gaattagttatggaattagaagatgaatttggtactgaaattccagatgaagaagctgaa aaaatcaacactgttggtgacgctgttaactttattaacagtcttgaaaaataa

DBGET integrated database retrieval system