Streptomyces armeniacus: DVA86_13715 Help Entry DVA86_13715       CDS       T10140                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sarm  Streptomyces armeniacus Pathway sarm00998   Biosynthesis of various antibiotics sarm01100   Metabolic pathways sarm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sarm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DVA86_13715    00074 Mycolic acid biosynthesis     DVA86_13715   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DVA86_13715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXK33546 UniProt:  A0A345XPI0 LinkDB All DBs Position 3139136..3139387 Genome browser AA seq 83 aa AA seqDB search MPVTIDEATEAKVREILVESLELEEELTRTGLFKEDYDADSLGAIEVLSALEKTFGVTIE QDELPNMVNFEAVLEVLSRAEAR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcctgtcaccatcgacgaagccaccgaggccaaggtccgcgagatcctcgtggagtcc ctggagctggaggaggagctgacccgcaccggcctgttcaaggaggactacgacgcggac tcgctcggtgccatcgaagtgctctccgcgctggagaagaccttcggcgtcaccatcgag caggacgaactcccgaacatggtcaacttcgaggccgtcctggaggtcctgtcccgggcc gaggcccgatga

DBGET integrated database retrieval system