Salmo salar (Atlantic salmon): 100136409 Help Entry 100136409         CDS       T04363                                  Symbol acbp Name (RefSeq) acyl-CoA-binding protein   KO K08762   diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein) Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa03320   PPAR signaling pathway Brite KEGG Orthology (KO) [BR:sasa00001]  09150 Organismal Systems   09152 Endocrine system    03320 PPAR signaling pathway     100136409 (acbp)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     100136409 (acbp) Cytokines and neuropeptides [BR:sasa04052]  Neuropeptides   Unclassified    100136409 (acbp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACBP Na_Ca_ex_C FERM_M Motif Other DBs NCBI-GeneID:  100136409 NCBI-ProteinID:  XP_014020239 UniProt:  B5XBV2 LinkDB All DBs Position ssa21:complement(30947463..30951487) Genome browser AA seq 87 aa AA seqDB search MSEADFDKAAEEVKQLKAKPADAEMLRVYALFKQAKVGDVNTARPGMLDFTGKAKWDAWE KEKGKSQEDARKEYIALVEELKGKYGV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtctgaggcagactttgataaggctgcagaggaggtgaagcagctgaaggccaagcca gcagatgcagagatgctcagggtttatgctctgttcaaacaggccaaagtgggcgatgtc aacaccgctcgtcctggaatgcttgatttcactgggaaagccaagtgggacgcctgggag aaggagaaaggaaagagccaagaggatgccaggaaggagtacattgccttggtagaggag cttaaagggaagtacggagtctaa

DBGET integrated database retrieval system