Salmo salar (Atlantic salmon): 100136581 Help Entry 100136581         CDS       T04363                                  Symbol MT-B, metB, mtb Name (RefSeq) metallothionein B   KO K14739   metallothionein 1/2 Organism sasa  Salmo salar (Atlantic salmon) Brite KEGG Orthology (KO) [BR:sasa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sasa03019]     100136581 (MT-B)    03029 Mitochondrial biogenesis [BR:sasa03029]     100136581 (MT-B) Messenger RNA biogenesis [BR:sasa03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100136581 (MT-B) Mitochondrial biogenesis [BR:sasa03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100136581 (MT-B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100136581 NCBI-ProteinID:  NP_001117141 UniProt:  P52720 Q0H917 LinkDB All DBs Position ssa10:complement(79383857..79384867) Genome browser AA seq 60 aa AA seqDB search MDPCECSKTGSCNCGGSCKCANCACTSCKKSCCPCCPSGCSKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgtgaatgctctaaaactggctcttgcaactgcggtggatcctgtaagtgc gccaactgcgcatgcaccagttgtaagaaaagttgctgcccctgctgtccttccggctgc agcaaatgtgcttcaggctgtgtgtgtaagggcaagacctgtgataccagctgttgtcag tga

DBGET integrated database retrieval system