Salmo salar (Atlantic salmon): 100194431 Help Entry 100194431         CDS       T04363                                  Symbol pyy Name (RefSeq) peptide YY   KO K05233   peptide YY Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100194431 (pyy)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     100194431 (pyy) Cytokines and neuropeptides [BR:sasa04052]  Neuropeptides   GPCR binding    100194431 (pyy) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  100194431 NCBI-ProteinID:  NP_001132995 UniProt:  B3IYK5 LinkDB All DBs Position ssa03:complement(56178950..56182827) Genome browser AA seq 97 aa AA seqDB search MAMILKPWTVLVALVLCVLVCLGTFVDAYPPKPENPGEDAPPEELAKYYTALRHYINLIT RQRYGKRSAQEGVMSELLFGNNAERDQRSRYDDSYMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggccatgatactgaaaccctggaccgtcttggtcgccttggtgttgtgcgtgctggtg tgtctcgggactttcgtggacgcctacccacctaaaccggagaaccctggagaagacgcg cctcctgaagagctggccaaatactacaccgcgctcagacactacatcaatctgatcacg agacagaggtacggtaagaggtccgcccaggagggagtgatgtcagagttgctgttcggc aacaatgcagagagagaccagagatcaagatatgacgactcctacatgtggtga

DBGET integrated database retrieval system