Salmo salar (Atlantic salmon): 100194543 Help Entry 100194543         CDS       T04363                                  Symbol hmgb1 Name (RefSeq) high-mobility group box 1   KO K10802   high mobility group protein B1 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa03410   Base excision repair sasa04140   Autophagy - animal sasa04217   Necroptosis Brite KEGG Orthology (KO) [BR:sasa00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     100194543 (hmgb1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100194543 (hmgb1)   09143 Cell growth and death    04217 Necroptosis     100194543 (hmgb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     100194543 (hmgb1)    03400 DNA repair and recombination proteins [BR:sasa03400]     100194543 (hmgb1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     100194543 (hmgb1) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     100194543 (hmgb1) DNA repair and recombination proteins [BR:sasa03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      100194543 (hmgb1)    MMR (mismatch excision repair)     Other MMR factors      100194543 (hmgb1) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100194543 (hmgb1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_box_5 NOA36 Dicty_REP Autophagy_act_C Motif Other DBs NCBI-GeneID:  100194543 NCBI-ProteinID:  NP_001133101 UniProt:  B5DG18 LinkDB All DBs Position ssa04:complement(79507729..79520691) Genome browser AA seq 203 aa AA seqDB search MGKDPRKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWRTMSAKEKGKFE DLAKLDKVRYEREMRSYIPPKGEKKKRFKDPNAPKRPSSAFFIFCADFRPQVKGETPGLS IGDVAKKLGEKWNNLTAEDKVPYEKKAAKLKEKYEKDITAYRNKGKVPVSVPAKAAAPTK DDDDDDDDDDDDEDDDDDDDDDE NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atggggaaagatccaaggaagccgaggggcaagatgtcctcctatgcctactttgtccag acctgtcgagaggagcacaagaagaaacacccggaagcttccgtcaacttctccgagttc tccaagaagtgctctgagagatggaggaccatgtccgccaaggagaaggggaagtttgag gatctggccaagctggacaaagtgcgttatgagagggagatgaggagctacattcctccc aagggagagaagaagaaaaggtttaaggaccccaacgcccccaagagaccatcgtctgct ttcttcatcttctgcgctgatttccgaccccaggtgaagggggagacccctggcctgtca ataggtgatgtggctaagaagctgggagagaagtggaacaacctaacagcggaggacaag gtgccctatgagaaaaaggctgccaagctgaaggagaagtacgagaaggacatcactgcg taccgcaacaagggcaaggtgcccgtcagcgtgccagcgaaggccgctgccccaaccaag gacgacgacgacgatgatgacgatgatgacgacgatgaagacgacgatgatgacgacgac gatgacgagtag

DBGET integrated database retrieval system