Salmo salar (Atlantic salmon): 100194654 Help Entry 100194654         CDS       T04363                                  Symbol UBIQ, Ubiquitin Name (RefSeq) ribosomal protein S27-3   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa03010   Ribosome sasa04120   Ubiquitin mediated proteolysis sasa04137   Mitophagy - animal sasa04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:sasa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     100194654 (UBIQ)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     100194654 (UBIQ)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100194654 (UBIQ)    04137 Mitophagy - animal     100194654 (UBIQ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sasa03011]     100194654 (UBIQ)    04121 Ubiquitin system [BR:sasa04121]     100194654 (UBIQ)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     100194654 (UBIQ) Ribosome [BR:sasa03011]  Ribosomal proteins   Eukaryotes    Small subunit     100194654 (UBIQ)   Archaea     100194654 (UBIQ) Ubiquitin system [BR:sasa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    100194654 (UBIQ) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100194654 (UBIQ)   Exosomal proteins of colorectal cancer cells    100194654 (UBIQ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Dsc3_N IBR DUF2604 Ubiquitin_5 TBK1_ULD OTU1_UBXL Motif Other DBs NCBI-GeneID:  100194654 NCBI-ProteinID:  NP_001133210 UniProt:  B5XF34 LinkDB All DBs Position ssa01:complement(68777053..68779433) Genome browser AA seq 156 aa AA seqDB search MQIFVKTLTGKAITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGAKKGKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRE CPAEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgcagattttcgtcaaaaccctcacggggaaggctataaccctcgaggttgagccttca gacaccattgaaaatgtcaaggccaaaatccaagacaaagaaggtatccctcccgatcag cagaggttgatcttcgctggtaagcagctggaggatggacgcacactgtccgactacaac attcagaaggagtccactctgcatttggtgctgagactgcgtgggggtgccaagaagggg aagaagaagtcctacaccactcccaaaaagaacaagcacaagaggaagaaggtcaagctc gcagtgctcaagtactacaaggttgatgaaaacggcaagatccaccgtctgcgtcgtgag tgtccagctgaagagtgtggcgctggtgtgttcatggccagccacttcgataggcactac tgtggcaagtgctgcctcacttactgcttcaacaagcctgaggacaagtaa

DBGET integrated database retrieval system