Salmo salar (Atlantic salmon): 100195875 Help Entry 100195875         CDS       T04363                                  Symbol ubl5 Name (RefSeq) Ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism sasa  Salmo salar (Atlantic salmon) Brite KEGG Orthology (KO) [BR:sasa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:sasa03041]     100195875 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     100195875 (ubl5) Spliceosome [BR:sasa03041]  Complex B   Other components    Complex B specific factors     100195875 (ubl5) Cytokines and neuropeptides [BR:sasa04052]  Neuropeptides   Unclassified    100195875 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  100195875 NCBI-ProteinID:  NP_001134376 UniProt:  B5X8T9 LinkDB All DBs Position ssa12:4586401..4590337 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGQNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtttgcaatgaccggctgggcaagaaggtccgggtgaagtgcaactca gaagacactataggagacctgaagaagctcatcgctgcccagacaggcacacggtgggac aagatcgtactcaagaaatggtacaccatattcaaggaccacgtgtctctgggagactat gagatccatgatgggcagaacctggagctgtactaccagtag

DBGET integrated database retrieval system