Salmo salar (Atlantic salmon): 100195999 Help Entry 100195999         CDS       T04363                                  Symbol cxl10 Name (RefSeq) C-X-C motif chemokine 10   KO K12671   C-X-C motif chemokine 10 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04060   Cytokine-cytokine receptor interaction sasa04620   Toll-like receptor signaling pathway sasa04622   RIG-I-like receptor signaling pathway sasa04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100195999 (cxl10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100195999 (cxl10)    04622 RIG-I-like receptor signaling pathway     100195999 (cxl10)    04623 Cytosolic DNA-sensing pathway     100195999 (cxl10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     100195999 (cxl10)    00536 Glycosaminoglycan binding proteins [BR:sasa00536]     100195999 (cxl10) Cytokines and neuropeptides [BR:sasa04052]  Cytokines   Chemokines    100195999 (cxl10) Glycosaminoglycan binding proteins [BR:sasa00536]  Heparan sulfate / Heparin   Chemokines    100195999 (cxl10) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100195999 NCBI-ProteinID:  NP_001134500 UniProt:  B5XAA1 A0A1S2X6F4 LinkDB All DBs Position ssa11:complement(50144428..50145681) Genome browser AA seq 88 aa AA seqDB search MRTATLILLCVTVFGAGFAQFPGGRSEKCLCRGKLMQSVRIKRIQKLEVYPNSVFCAKTE IIATMKNGKKKCLNPEGKLGKRFLMRKR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaggacagcaactttgatcctgctttgtgtaacagtcttcggagctggatttgctcaa ttccctggtggaagatctgagaaatgtctatgcaggggaaaactaatgcagtctgttagg ataaaacgcatccagaagttagaggtgtacccaaattctgtcttctgtgcaaagacagaa attattgccacaatgaagaatggtaagaaaaaatgtctgaacccagagggcaagttagga aaaagattcctgatgagaaaaaggtaa

DBGET integrated database retrieval system