Salmo salar (Atlantic salmon): 100196603 Help Entry 100196603         CDS       T04363                                  Symbol rash Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04510   Focal adhesion sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04916   Melanogenesis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100196603 (rash)    04012 ErbB signaling pathway     100196603 (rash)    04370 VEGF signaling pathway     100196603 (rash)    04371 Apelin signaling pathway     100196603 (rash)    04068 FoxO signaling pathway     100196603 (rash)    04150 mTOR signaling pathway     100196603 (rash)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100196603 (rash)    04140 Autophagy - animal     100196603 (rash)    04137 Mitophagy - animal     100196603 (rash)   09143 Cell growth and death    04210 Apoptosis     100196603 (rash)    04218 Cellular senescence     100196603 (rash)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100196603 (rash)    04540 Gap junction     100196603 (rash)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100196603 (rash)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100196603 (rash)   09152 Endocrine system    04910 Insulin signaling pathway     100196603 (rash)    04912 GnRH signaling pathway     100196603 (rash)    04916 Melanogenesis     100196603 (rash)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100196603 (rash)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     100196603 (rash)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     100196603 (rash)    04031 GTP-binding proteins [BR:sasa04031]     100196603 (rash) Membrane trafficking [BR:sasa04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100196603 (rash)  Endocytosis   Macropinocytosis    Ras GTPases     100196603 (rash) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100196603 (rash)   Exosomal proteins of colorectal cancer cells    100196603 (rash) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100196603 (rash) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin AAA_16 Motif Other DBs NCBI-GeneID:  100196603 NCBI-ProteinID:  NP_001135104 UniProt:  B5X1B6 LinkDB All DBs Position ssa10:complement(89279483..89304908) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatacgaccccaccatagaggactcatac aggaagcaggtggtgattgacggggagacatgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggaacagatc aagcgtgtgaaagactctgatgacgtgcccatggtcctggtgggtaataaatgtgacctc ccatcgcgtaccgtggacacgcggcaagcacaggaactggcccgcagctacggaattccc tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgttagtg agagagatcaggcagcacaagctgaggaagctcaaccctccggacgagagtggacaggac tgcatgagctgccgctgtgtggtgtcgtga

DBGET integrated database retrieval system