Salmo salar (Atlantic salmon): 100196881 Help Entry 100196881         CDS       T04363                                  Symbol dylt3 Name (RefSeq) Dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04814   Motor proteins sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     100196881 (dylt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100196881 (dylt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sasa03037]     100196881 (dylt3)    04812 Cytoskeleton proteins [BR:sasa04812]     100196881 (dylt3) Cilium and associated proteins [BR:sasa03037]  Motile cilia and associated proteins   Dynein arm    100196881 (dylt3) Cytoskeleton proteins [BR:sasa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      100196881 (dylt3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 TPR_ATM Motif Other DBs NCBI-GeneID:  100196881 NCBI-ProteinID:  NP_001135375 UniProt:  B5XGQ0 LinkDB All DBs Position ssa16:complement(74675293..74678157) Genome browser AA seq 114 aa AA seqDB search MEEFSGDEGSFNSEEASNSVKECIQSIIGEESYRQDTVNQWTAKIVEQALTLLVKQTKSY KYIVSCAVMQKSGAGLHTANSCYWDTVTDGSCTVKWENRTMYCVVSVFAVALTP NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaggaattttctggtgacgagggctctttcaactctgaagaggccagtaactccgtg aaagagtgtattcagagtatcattggagaagagagctacagacaggacactgtgaaccag tggacagccaagattgtggagcaagccctcaccctgctggtcaaacagactaagtcatac aagtacattgttagctgtgctgtcatgcagaagagtggtgctggtctccacaccgctaac tcctgctactgggacactgttactgatgggagctgcacagtgaagtgggagaaccgcacc atgtactgtgtggtcagtgtgtttgctgtggccttaaccccctag

DBGET integrated database retrieval system