Salmo salar (Atlantic salmon): 106562341 Help Entry 106562341         CDS       T04363                                  Name (RefSeq) ras-related protein R-Ras2-like   KO K07830   Ras-related protein R-Ras2 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04218   Cellular senescence sasa04371   Apelin signaling pathway sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106562341    04371 Apelin signaling pathway     106562341  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106562341    04137 Mitophagy - animal     106562341   09143 Cell growth and death    04218 Cellular senescence     106562341   09142 Cell motility    04810 Regulation of actin cytoskeleton     106562341  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106562341  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106562341    04031 GTP-binding proteins [BR:sasa04031]     106562341 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106562341   Exosomal proteins of bladder cancer cells    106562341 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106562341 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SLFN-g3_helicase NPHI_C MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  106562341 NCBI-ProteinID:  XP_013982633 UniProt:  A0A1S3KVC5 LinkDB All DBs Position ssa11:25240530..25247236 Genome browser AA seq 127 aa AA seqDB search MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLELQRQV TQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKS GCHCVIV NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgagagaacaatacatgaggacaggggagggcttcctgcttgtcttctcagtcactgac agaggaagctttgaagaaatctacaaattccaaagacagatcctcagagtcaaagaccgt gatgaatttcccatgatccttgtaggcaataaagcagatctggagctccagagacaggtg acccaggaggagggccagcagctggccagacagctcaaggtgacgtatatggaggcctca gccaaaatccgtatgaatgtagaccaggctttccacgagctggttagagtaatcaggaaa ttccaggaacaggaatgcccaccatcgccagaacccacgcggaaagaaaaggacaagagt ggctgccattgtgtgatcgtctga

DBGET integrated database retrieval system