Salmo salar (Atlantic salmon): 106565140 Help Entry 106565140         CDS       T04363                                  Symbol RHOA Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04081   Hormone signaling sasa04144   Endocytosis sasa04150   mTOR signaling pathway sasa04270   Vascular smooth muscle contraction sasa04310   Wnt signaling pathway sasa04350   TGF-beta signaling pathway sasa04510   Focal adhesion sasa04520   Adherens junction sasa04530   Tight junction sasa04621   NOD-like receptor signaling pathway sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa05100   Bacterial invasion of epithelial cells sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106565140 (RHOA)    04350 TGF-beta signaling pathway     106565140 (RHOA)    04150 mTOR signaling pathway     106565140 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     106565140 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106565140 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     106565140 (RHOA)    04520 Adherens junction     106565140 (RHOA)    04530 Tight junction     106565140 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106565140 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106565140 (RHOA)    04625 C-type lectin receptor signaling pathway     106565140 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     106565140 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106565140 (RHOA)    05100 Bacterial invasion of epithelial cells     106565140 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106565140 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106565140 (RHOA)    04031 GTP-binding proteins [BR:sasa04031]     106565140 (RHOA) Membrane trafficking [BR:sasa04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     106565140 (RHOA) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106565140 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    106565140 (RHOA)   Exosomal proteins of colorectal cancer cells    106565140 (RHOA)   Exosomal proteins of bladder cancer cells    106565140 (RHOA) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     106565140 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  106565140 NCBI-ProteinID:  XP_013987402 UniProt:  B5X7H3 LinkDB All DBs Position ssa12:45586037..45591938 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKPRNKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccatccgaaagaagctggtcatagtgggagatggcgcatgtggtaagacgtgt ctgctcatcgtcttcagtaaagaccagttccccgaggtctacgtgcccactgtcttcgag aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca gcaggccaggaggactatgataggctccgccccctatcttacccagatacagatgtcatc cttatgtgcttctccatcgatagccctgacagtttggaaaacatcccagagaaatggact ccagaggtcaaacacttctgtcccaacgttcccatcatcctagtgggcaacaaaaaggac ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag ccagaggagggacgtgacatggcgaaccggatcagtgccttcggctacatggagtgctct gcaaagaccaaggatggtgtgagggaagtgtttgagatggccaccagggcagcgctacag gcccggcgggggaagccaagaaataaatgcctcctactgtaa

DBGET integrated database retrieval system