Salmo salar (Atlantic salmon): 106565552 Help Entry 106565552         CDS       T04363                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04145   Phagosome sasa04148   Efferocytosis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106565552    04145 Phagosome     106565552    04140 Autophagy - animal     106565552    04137 Mitophagy - animal     106565552    04148 Efferocytosis     106565552  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106565552  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106565552   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106565552    04031 GTP-binding proteins [BR:sasa04031]     106565552 Membrane trafficking [BR:sasa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106565552 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106565552   Exosomal proteins of other body fluids (saliva and urine)    106565552   Exosomal proteins of colorectal cancer cells    106565552   Exosomal proteins of bladder cancer cells    106565552 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106565552 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 AAA_7 NTPase_1 AAA_24 AAA_5 ATPase_2 ABC_tran NACHT Motif Other DBs NCBI-GeneID:  106565552 NCBI-ProteinID:  XP_013988286 UniProt:  A0A1S3LBF4 LinkDB All DBs Position ssa12:complement(57760298..57780095) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKTSAEACTC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcctgaaagtcatcatcctgggggattctggagttggg aagacctccctgatgaaccagtatgtgaataggaagttcagtaaccagtacaaagctaca ataggagctgacttcctgaccaaggaggtgatggtggacgatcggctcgttacaatgcag atctgggacacggcagggcaagagaggttccagtctctgggtgtggcgttctaccgcggg gcagactgctgtgtgctggtgtttgacgtaactgcccccaacaccttcaagactctagac agttggagggacgagttcctgatccaggccagtcccagagaccctgagaacttccccttt gtggtgctaggcaacaagattgacctggagaacagacaggtgacgaccaagcgggctcag gcatggtgtcagagtaagaacaacatcccttactttgagaccagtgctaaggaggccatc aacgtagagcaggccttccagaccattgcacgcaacgccctcaaacaggagactgaggtg gagctgtataatgaattcccggagcccatcaagctagacaggaatgacagagcaaagact tcagcagaggcctgcacctgctga

DBGET integrated database retrieval system