Salmo salar (Atlantic salmon): 106567937 Help Entry 106567937         CDS       T04363                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04145   Phagosome sasa04148   Efferocytosis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106567937 (RAB7A)    04145 Phagosome     106567937 (RAB7A)    04140 Autophagy - animal     106567937 (RAB7A)    04137 Mitophagy - animal     106567937 (RAB7A)    04148 Efferocytosis     106567937 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106567937 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106567937 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106567937 (RAB7A)    04031 GTP-binding proteins [BR:sasa04031]     106567937 (RAB7A) Membrane trafficking [BR:sasa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106567937 (RAB7A) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106567937 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    106567937 (RAB7A)   Exosomal proteins of colorectal cancer cells    106567937 (RAB7A)   Exosomal proteins of bladder cancer cells    106567937 (RAB7A) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106567937 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP AAA_16 NTPase_1 Septin AAA_22 AAA_24 AAA_7 DUF5992 AAA_5 ATPase_2 SRPRB NACHT ABC_tran NB-ARC Motif Other DBs NCBI-GeneID:  106567937 NCBI-ProteinID:  XP_013993329 UniProt:  B5X431 LinkDB All DBs Position ssa01:complement(136983670..136988069) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDERPSSSSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacatctctgatgaaccagtatgtaaataagaggttcagcaaccaatacaaggccact ataggagctgacttcctcaccaaggaggtgatggtggatgacaggctggtcaccatgcag atctgggacacggcggggcaggagcggtttcaatctctgggtgtggcgttctatcgtggg gctgactgctgtgtgctggtctatgatgtcacagcgcccaacacctttaagactctggac agttggagggatgagttcctgatccaggccagccccagagacccagataacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacgacaaagcgtgcccag gcctggtgtgccagtaagaacaacatcccctactttgagaccagtgccaaggaggccatc aacgtagaccaagcattccagaccatcgcccgcaacgccctcaaacaggagtctgaggtg gagacgtatgacttcccagaccagatcaaactgagagacgagcggccctcctcctccagc gacggctgctcctgctga

DBGET integrated database retrieval system