Salmo salar (Atlantic salmon): 106570100 Help Entry 106570100         CDS       T04363                                  Symbol S10A1, s100-a1, s100a1 Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106570100 (S10A1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106570100 (S10A1)    04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]     106570100 (S10A1) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of microglial cells    106570100 (S10A1) Domain-containing proteins not elsewhere classified [BR:sasa04990]  EF-hand domain-containing proteins   S100 proteins    106570100 (S10A1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd Bcl-2 EF-hand_4 DEK_C Motif Other DBs NCBI-GeneID:  106570100 NCBI-ProteinID:  XP_013997577 UniProt:  B9ELE1 LinkDB All DBs Position ssa14:52545030..52547043 Genome browser AA seq 99 aa AA seqDB search MPSELERAMESMITVFHKYAAKEGNGNTLSRRELRDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccatcagaactggaacgagcaatggagtccatgatcactgtgttccacaagtatgct gctaaggagggcaatggcaacactctgagccgccgtgagctaagggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccagccacagtagacaagatcatgaag gatctggactccaatggtgatggagaggtgaactttgaggagtttgtttctctagttgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system