Salmo salar (Atlantic salmon): 106573361 Help Entry 106573361         CDS       T04363                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04510   Focal adhesion sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04916   Melanogenesis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106573361    04012 ErbB signaling pathway     106573361    04370 VEGF signaling pathway     106573361    04371 Apelin signaling pathway     106573361    04068 FoxO signaling pathway     106573361    04150 mTOR signaling pathway     106573361  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106573361    04140 Autophagy - animal     106573361    04137 Mitophagy - animal     106573361   09143 Cell growth and death    04210 Apoptosis     106573361    04218 Cellular senescence     106573361   09144 Cellular community - eukaryotes    04510 Focal adhesion     106573361    04540 Gap junction     106573361   09142 Cell motility    04810 Regulation of actin cytoskeleton     106573361  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106573361   09152 Endocrine system    04910 Insulin signaling pathway     106573361    04912 GnRH signaling pathway     106573361    04916 Melanogenesis     106573361  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106573361  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106573361   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106573361    04031 GTP-binding proteins [BR:sasa04031]     106573361 Membrane trafficking [BR:sasa04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     106573361  Endocytosis   Macropinocytosis    Ras GTPases     106573361 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    106573361   Exosomal proteins of colorectal cancer cells    106573361 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106573361 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin G-alpha AAA_16 Motif Other DBs NCBI-GeneID:  106573361 NCBI-ProteinID:  XP_014003820 UniProt:  A0A1S3ML54 LinkDB All DBs Position ssa16:21336903..21376881 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggcaggaggtgtgggaaagagtgcactcacc atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaagcaggtggtgattgatggggagacatgtctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccaatacagggaacagatc aagcgtgtgaaggactctgacgatgtaccgatggtgctggtgggtaataaatgtgacctc ccggcgtgtaccgtggacacgcggcaagcacaggaactggcccgcagctatggaattccc tacattgagacctcagccaagacacgacagggggtagaggatgccttctacacactagtg agagagatcagacaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac tgcatgagctgccgctgtgtggtgtcttga

DBGET integrated database retrieval system