Salmo salar (Atlantic salmon): 106576885 Help Entry 106576885         CDS       T04363                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04068   FoxO signaling pathway sasa04136   Autophagy - other sasa04140   Autophagy - animal sasa04621   NOD-like receptor signaling pathway sasa04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     106576885  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106576885    04136 Autophagy - other     106576885  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106576885    04622 RIG-I-like receptor signaling pathway     106576885  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106576885    04121 Ubiquitin system [BR:sasa04121]     106576885    03029 Mitochondrial biogenesis [BR:sasa03029]     106576885 Membrane trafficking [BR:sasa04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     106576885 Ubiquitin system [BR:sasa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    106576885 Mitochondrial biogenesis [BR:sasa03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     106576885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  106576885 NCBI-ProteinID:  XP_014009888 UniProt:  A0A1S3N328 LinkDB All DBs Position ssa02:11109391..11112644 Genome browser AA seq 120 aa AA seqDB search MSDNAESPTETQKDEPSTPQQPTEDLGTADEKKKIDVLLKAVGDTPIMKTKKWSVEKGRT VQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagagtctcctacagaaacgcaaaaagatgagccttcaaccccacaa cagcctacggaagacttggggacggcagacgagaagaaaaaaattgatgtgttgttgaag gcagtaggagacacccccatcatgaagacaaagaaatggtcagtagagaaagggaggaca gtgcaatcactctctcagttcatctctcgattcctcaagatggaggccaatgaacaactg ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggtgtcctgttt gaatgttttggcagcgatgggaagcttgttctacattattgtaaatctcaagcctggggt taa

DBGET integrated database retrieval system