Salmo salar (Atlantic salmon): 106579849 Help Entry 106579849         CDS       T04363                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04145   Phagosome sasa04148   Efferocytosis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106579849 (RAB7A)    04145 Phagosome     106579849 (RAB7A)    04140 Autophagy - animal     106579849 (RAB7A)    04137 Mitophagy - animal     106579849 (RAB7A)    04148 Efferocytosis     106579849 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106579849 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106579849 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106579849 (RAB7A)    04031 GTP-binding proteins [BR:sasa04031]     106579849 (RAB7A) Membrane trafficking [BR:sasa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106579849 (RAB7A) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106579849 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    106579849 (RAB7A)   Exosomal proteins of colorectal cancer cells    106579849 (RAB7A)   Exosomal proteins of bladder cancer cells    106579849 (RAB7A) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106579849 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase PduV-EutP cobW ATP_bind_1 nSTAND3 Septin AAA_16 AAA_22 AAA_7 NTPase_1 AAA_24 G-alpha AAA_5 SRPRB DUF5992 ATPase_2 NACHT NB-ARC ATP-synt_ab AAA_14 ABC_tran Motif Other DBs NCBI-GeneID:  106579849 NCBI-ProteinID:  XP_014015612 UniProt:  B5X127 LinkDB All DBs Position ssa20:complement(23700186..23703573) Genome browser AA seq 205 aa AA seqDB search MASRKKILLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCTSKGSIPYFETSAKEAINVDQAFQTICRNALKQESEV ETYDFPDQIKLRDDRPASSSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcggaagaagattctactcaaggtgataattcttggagactcaggagttggg aagacctctctcatgaaccaatatgtgaataagaagttcagcaatcagtataaggccaca atcggtgctgactttcttaccaaagaggtgatggtggatgacaggcttgtgacaatgcag atctgggacactgcagggcaggagagattccagtcattgggcgttgctttctatcgaggt gcagactgttgtgtccttgtgtacgatgttactgctccaaacaccttcaagactcttgac agctggcgagacgagttcctgattcaagccagcccccgtgacccagagaacttcccattt gttgtgctcggcaacaagattgacttggagaacaggcaggtgacgaccaagagagcccag gcgtggtgtacgagtaagggcagtatcccatatttcgagacaagtgcgaaggaggccatc aatgttgatcaagcctttcaaactatttgccgaaatgctctcaaacaggagtcagaagtg gagacttatgacttcccagatcagatcaaactgagggatgacagaccagcttcctccagt gatggctgcagctgctga

DBGET integrated database retrieval system