Salmo salar (Atlantic salmon): 106582926 Help Entry 106582926         CDS       T04363                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04145   Phagosome sasa04148   Efferocytosis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106582926 (RAB7A)    04145 Phagosome     106582926 (RAB7A)    04140 Autophagy - animal     106582926 (RAB7A)    04137 Mitophagy - animal     106582926 (RAB7A)    04148 Efferocytosis     106582926 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106582926 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106582926 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106582926 (RAB7A)    04031 GTP-binding proteins [BR:sasa04031]     106582926 (RAB7A) Membrane trafficking [BR:sasa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106582926 (RAB7A) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106582926 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    106582926 (RAB7A)   Exosomal proteins of colorectal cancer cells    106582926 (RAB7A)   Exosomal proteins of bladder cancer cells    106582926 (RAB7A) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106582926 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  106582926 NCBI-ProteinID:  XP_014022029 UniProt:  A0A1S3P354 LinkDB All DBs Position ssa22:complement(17372515..17380081) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERSKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaagtactacttaaagtaatcatcctgggagactctggagttggg aagacgtccctgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca attggagctgatttcctgacgaaagaagtgatggtggacgacaggcttgtcaccatgcag atctgggacacagcggggcaggagaggttccagtctctgggcgtggcgttctaccgcggg gcagactgttgcgtgctggtgtttgacgtgaccgcccccaacaccttcaagaccctagac agctggagggacgagttcctgatccaggccagcccccgagaccccgagaacttccccttt gtggtgctaggcaacaagattgacctggagaacagacaggtgacgactaaacgagcacag gcctggtgtcagagcaagaacaacatcccctacttcgagaccagcgcaaaggaggccatc aacgttgaacaggctttccagactatcgcacgcaatgctcttaaacaggagacagaggtg gagttgtacaatgagttccctgaaccgataaagctggacaggaacgaacgttccaagcca tcagcggaggcctgcagctgctga

DBGET integrated database retrieval system