Salmo salar (Atlantic salmon): 106582967 Help Entry 106582967         CDS       T04363                                  Symbol MYCBP Name (RefSeq) C-Myc-binding protein-like   KO K25550   c-Myc-binding protein Organism sasa  Salmo salar (Atlantic salmon) Brite KEGG Orthology (KO) [BR:sasa00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sasa03037]     106582967 (MYCBP) Cilium and associated proteins [BR:sasa03037]  Motile cilia and associated proteins   Sperm associated proteins    106582967 (MYCBP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MAD TSC22 DUF4200 bZIP_1 SOG2 MCU SlyX Motif Other DBs NCBI-GeneID:  106582967 NCBI-ProteinID:  XP_014022090 UniProt:  A0A1S3P392 LinkDB All DBs Position ssa02:complement(28453294..28457800) Genome browser AA seq 105 aa AA seqDB search MKKDVHLASESKREHFRRYLEKAGVLDSLTSVLVALYEETEKPNNALDFLKQHLGVAGQE SADTEALQQELRDMRQRCELLAEENKDLKNRLQRYEPTQEDGAAE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggatgttcacttggcttcagagtccaaacgagagcattttcggagatacctg gagaaggctggtgtccttgacagcctcaccagtgtgctggtggcattgtatgaagagacg gagaaacccaacaatgcccttgatttcctcaagcagcacttgggtgtggctggccaggag tctgcagacactgaggcactccagcaggagctgagagacatgaggcagaggtgtgagctg ctggcggaggaaaacaaagacctcaagaacaggcttcagcgctatgagcctacgcaagag gatggcgctgccgaataa

DBGET integrated database retrieval system