Salmo salar (Atlantic salmon): 106583462 Help Entry 106583462         CDS       T04363                                  Symbol RHOA Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04144   Endocytosis sasa04150   mTOR signaling pathway sasa04270   Vascular smooth muscle contraction sasa04310   Wnt signaling pathway sasa04350   TGF-beta signaling pathway sasa04510   Focal adhesion sasa04520   Adherens junction sasa04530   Tight junction sasa04621   NOD-like receptor signaling pathway sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106583462 (RHOA)    04350 TGF-beta signaling pathway     106583462 (RHOA)    04150 mTOR signaling pathway     106583462 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106583462 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     106583462 (RHOA)    04520 Adherens junction     106583462 (RHOA)    04530 Tight junction     106583462 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     106583462 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106583462 (RHOA)    04625 C-type lectin receptor signaling pathway     106583462 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     106583462 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106583462 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106583462 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106583462 (RHOA)    04031 GTP-binding proteins [BR:sasa04031]     106583462 (RHOA) Membrane trafficking [BR:sasa04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     106583462 (RHOA) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106583462 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    106583462 (RHOA)   Exosomal proteins of colorectal cancer cells    106583462 (RHOA)   Exosomal proteins of bladder cancer cells    106583462 (RHOA) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     106583462 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  106583462 NCBI-ProteinID:  XP_014023137 UniProt:  A0A1S3P6B5 LinkDB All DBs Position ssa22:complement(41636079..41649749) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYMECSAKSKDGVREVFEMATRAALQ ARRGKQRHKCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatccgaaagaaactggtcatagtgggagacggagcgtgtgggaagacgtgt ctgctcatcgttttcagtaaagatcagttccccgaggtctacgtgcccactgtcttcgag aactatgtcgctgacattgaggtcgacagcaaacaggttgagttggcactatgggataca gcaggccaggaggactatgataggctccgtcccctctcttacccagataccgatgtcatc ctcatgtgcttctccattgatagccccgacagtttggaaaacatcccggagaagtggact ccagaagtcaaacacttctgccctaacgttcccattatcctagtgggcaacaaaaaggac ctgcgtaacgacgagcacacccgcagagagctagccaagatgaagcaggagcctgtgaag ccagaggaggggcgtgacatggcgaaccggatcagtgccttcggctacatggagtgctct gcaaagagcaaggatggggtgagggaagtgtttgagatggccacgagggcggcgctacag gcccggcgggggaagcagagacataaatgcctcctactgtaa

DBGET integrated database retrieval system