Salmo salar (Atlantic salmon): 106587941 Help Entry 106587941         CDS       T04363                                  Symbol CCL13 Name (RefSeq) C-C motif chemokine 13-like   KO K16595   C-C motif chemokine 13 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04060   Cytokine-cytokine receptor interaction Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106587941 (CCL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     106587941 (CCL13)    00536 Glycosaminoglycan binding proteins [BR:sasa00536]     106587941 (CCL13) Cytokines and neuropeptides [BR:sasa04052]  Cytokines   Chemokines    106587941 (CCL13) Glycosaminoglycan binding proteins [BR:sasa00536]  Heparan sulfate / Heparin   Chemokines    106587941 (CCL13) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Reo_sigmaC_M Motif Other DBs NCBI-GeneID:  106587941 NCBI-ProteinID:  XP_014032076 UniProt:  B5X8C5 A0A1S3PWM9 LinkDB All DBs Position ssa26:complement(41504406..41505497) Genome browser AA seq 93 aa AA seqDB search MKTLTALLLLGLLCSLHKTSAGVIELDMAPYCCMKFSARIPLQQVVSLRPTASSCPRKAL IFTTKKGKTFCVDPSEAWVQSHVTKIESRSTAA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaagaccctgactgctctactcctcctgggactgctctgctccctccataagacgtct gccggtgtcattgagttggacatggcaccttactgctgtatgaaattcagcgcgaggatc cctcttcaacaagtggtttctctcagaccaactgccagtagctgccctcgcaaagcactg attttcaccacaaagaaagggaagacattttgtgttgacccttctgaagcctgggtccag agtcatgtgaccaagattgagagcagatcgactgctgcctag

DBGET integrated database retrieval system