Salmo salar (Atlantic salmon): 106588175 Help Entry 106588175         CDS       T04363                                  Symbol S100-A1, S10A1 Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04382   Cornified envelope formation sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106588175 (S100-A1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106588175 (S100-A1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106588175 (S100-A1) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of microglial cells    106588175 (S100-A1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 DAXX_hist_bd Bcl-2 Motif Other DBs NCBI-GeneID:  106588175 NCBI-ProteinID:  XP_014032374 UniProt:  B5XAP5 LinkDB All DBs Position ssa27:1142743..1145388 Genome browser AA seq 99 aa AA seqDB search MPSELERAMESMITVFHKYAAKEGSGNTLSRRELKDLMENELSGFLKSQKDPTTVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccgtcagaactggaacgtgccatggagtccatgatcaccgtgttccacaagtatgct gctaaggagggcagtggcaacactttgagccgccgtgagctcaaggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccaaccacagtagacaagataatgaag gatctggactctaatggtgacggagaggtgaactttgaggagtttgtttctctagtcgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system