Salmo salar (Atlantic salmon): 106594671 Help Entry 106594671         CDS       T04363                                  Symbol arf6 Name (RefSeq) ADP ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04144   Endocytosis sasa04517   IgSF CAM signaling sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     106594671 (arf6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106594671 (arf6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106594671 (arf6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106594671 (arf6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106594671 (arf6)    04031 GTP-binding proteins [BR:sasa04031]     106594671 (arf6) Membrane trafficking [BR:sasa04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     106594671 (arf6)   Arf GTPases and associated proteins    Arf GTPases     106594671 (arf6) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106594671 (arf6)   Exosomal proteins of colorectal cancer cells    106594671 (arf6) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     106594671 (arf6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  106594671 NCBI-ProteinID:  XP_014041566 UniProt:  B5X494 LinkDB All DBs Position ssa01:complement(25730621..25735032) Genome browser AA seq 176 aa AA seqDB search MMGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKF NVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILI FANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNYKS NT seq 531 nt NT seq  +upstreamnt  +downstreamnt atgatggggaaaatgctatcgaaaatctttggcaacaaggagatgagaatattgatgctt ggacttgatgctgctggaaagaccaccatcctttacaaactgaaacttggacagtcagtc accacaattcccacagttggtttcaacgttgagactgtgacttacaaaaacgtaaaattc aatgtatgggacgttggaggccaagataagatccgtcccctgtggcgacactactacacg ggcactcaagggttaatctttgttgtggattgcgcagacagagatcgcattgatgaggcc aggcaggaactccatcgcatcattaatgaccgtgagatgagggatgccatcatcttgatt tttgccaataagcaagacctgcccgatgccatgaaaccacacgaaatccaagagaaacta ggattgacccgcatcagagataggaattggtatgttcagccctcctgtgcgaccacggga gacggactatatgaggggttgacatggctaacatcaaattacaaatcctaa

DBGET integrated database retrieval system