Salmo salar (Atlantic salmon): 106598325 Help Entry 106598325         CDS       T04363                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04145   Phagosome sasa04148   Efferocytosis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106598325    04145 Phagosome     106598325    04140 Autophagy - animal     106598325    04137 Mitophagy - animal     106598325    04148 Efferocytosis     106598325  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106598325  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106598325   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106598325    04031 GTP-binding proteins [BR:sasa04031]     106598325 Membrane trafficking [BR:sasa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106598325 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106598325   Exosomal proteins of other body fluids (saliva and urine)    106598325   Exosomal proteins of colorectal cancer cells    106598325   Exosomal proteins of bladder cancer cells    106598325 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106598325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 Motif Other DBs NCBI-GeneID:  106598325 NCBI-ProteinID:  XP_014044847 UniProt:  A0A1S3QYZ0 LinkDB All DBs Position Un Genome browser AA seq 152 aa AA seqDB search MPLPCALSQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQAS PRDPENFPFVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIAR NALKQVGGQKGAYESLAECRVCIDSIFILCFY NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgcccctcccctgtgctctgtcacagatctgggacacagcggggcaggagaggttccag tctctgggcgtggcgttctaccgcggggcagactgttgcgtgctggtgtttgacgtgacc gcccccaacaccttcaagaccctagacagctggagggacgagttcctgatccaggccagc ccccgagaccccgagaacttcccctttgtggtgctaggcaacaagattgacctggagaac agacaggtgacgactaaacgagcacaggcctggtgtcagagcaagaacaacatcccctac ttcgagaccagcgcaaaggaggccatcaacgttgaacaggctttccagactatcgcacgc aatgctcttaaacaggtagggggtcagaagggagcttatgagagcttagctgaatgccgt gtgtgtattgacagtatttttatactttgtttttattga

DBGET integrated database retrieval system