Salmo salar (Atlantic salmon): 106599169 Help Entry 106599169         CDS       T04363                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism sasa  Salmo salar (Atlantic salmon) Brite KEGG Orthology (KO) [BR:sasa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106599169   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106599169 Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106599169 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106599169 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S TFIID-31kDa CBFD_NFYB_HMF THSD1_D2 Motif Other DBs NCBI-GeneID:  106599169 NCBI-ProteinID:  XP_014045761 LinkDB All DBs Position Un Genome browser AA seq 115 aa AA seqDB search ATKAARKSAPATGGLKNPHRVLPGTVALKEIRRYQKSTDLLIRSLPFLLLVREIAPHFKT DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 348 nt NT seq  +upstreamnt  +downstreamnt gccaccaaggctgcgcgcaagagcgccccggccaccggcggcttgaaaaaccctcaccgt gttttgcccggcaccgtggctctgaaagagatccgtcgttaccagaagtccactgatctg ctgatccgctcactgcccttccttctcctggtgagagaaattgccccccacttcaagacc gacctgcgcttccagagttccgccgtgatggccctgcaggaggctagcgaggcttacctg gtcggcctgttcgaggacaccaacctgtgcgccatccacgccaagagggtgaccatcatg cccaaggacatccagctggcccgtcgtattcgcggagagcgcgcttaa

DBGET integrated database retrieval system