Salmo salar (Atlantic salmon): 106604893 Help Entry 106604893         CDS       T04363                                  Symbol pfn3 Name (RefSeq) profilin 3   KO K05759   profilin Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04810   Regulation of actin cytoskeleton sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106604893 (pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106604893 (pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106604893 (pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sasa04812]     106604893 (pfn3)    04147 Exosome [BR:sasa04147]     106604893 (pfn3) Membrane trafficking [BR:sasa04131]  Others   Actin-binding proteins    Others     106604893 (pfn3) Cytoskeleton proteins [BR:sasa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      106604893 (pfn3) Exosome [BR:sasa04147]  Exosomal proteins   Proteins found in most exosomes    106604893 (pfn3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  106604893 NCBI-ProteinID:  XP_014055484 UniProt:  A0A1S3RUS5 LinkDB All DBs Position ssa05:37175932..37176664 Genome browser AA seq 139 aa AA seqDB search MAEWRDYIKATLKEKFVEDVAIVGLYDNKAVWASKPGGVLAAICPPEVEALVGKDRGSLL QEGVSVGGRKMAVIRDHMTGPETEILFIDIRTKGSESLALTVALTTKALVFVMGKRGVHG GIVNKKVCDMAKYLRERGV NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcagagtggagggactatatcaaagccactctgaaggagaagtttgtggaggacgta gccatcgttggcctgtacgacaacaaggccgtgtgggcctccaagcctggaggtgttctg gctgccatctgcccaccagaagtggaggctctggtgggcaaagacagaggaagtctcctg caggagggggtcagcgttggaggtcggaagatggcagtgatacgagaccatatgacaggt cctgagacagagatcctattcattgacatccggaccaaaggcagcgagagtttggctctc acggttgccctgacgaccaaggctctggtgtttgtgatgggaaaacgaggggtgcatggc gggatagtcaacaagaaggtgtgtgacatggccaagtacctccgcgagaggggtgtgtga

DBGET integrated database retrieval system