Salmo salar (Atlantic salmon): 106606009 Help Entry 106606009         CDS       T04363                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04382   Cornified envelope formation sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106606009  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106606009  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106606009 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of microglial cells    106606009 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 Rep3_C DEK_C HalOD1 Astro_p19 Motif Other DBs NCBI-GeneID:  106606009 NCBI-ProteinID:  XP_014057541 UniProt:  A0A1S3RZ87 LinkDB All DBs Position ssa05:74535578..74538537 Genome browser AA seq 101 aa AA seqDB search MPSQLERSMESLITVFHRYADKDGDCNTLSKKELKELMQTELDSFLKSQKDPAAIDKIMK DLDQNGDGKVSFEEFVSLVVGLSIACEQIYQLHTQKVAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagatccatggagtccctgatcacggtgttccatcgctatgcc gacaaggatggtgactgcaacacactgagcaagaaggagctgaaagagctgatgcagaca gaactggacagcttcctgaagtctcagaaggacccagccgccatagacaagatcatgaag gatctggaccagaatggtgatgggaaggtgagctttgaggagtttgtctctctggtggtg ggcctctccatcgcctgtgaacagatctaccagctccacacccagaaggttgctgccaag aagtga

DBGET integrated database retrieval system