Salmo salar (Atlantic salmon): 106606015 Help Entry 106606015         CDS       T04363                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04382   Cornified envelope formation sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106606015  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106606015  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106606015 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of microglial cells    106606015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DEK_C EH DAXX_hist_bd Motif Other DBs NCBI-GeneID:  106606015 NCBI-ProteinID:  XP_014057550 UniProt:  A0A1S3RZA3 LinkDB All DBs Position ssa05:74505042..74505840 Genome browser AA seq 101 aa AA seqDB search MLSQLERSMQSLITVFHRYADKDGDCNTLSKKELKELMQTELGSFLKSQKDPAAIDKIMK NLDQNGDGMVNFEEFVSLVVDLSIACEQIYQLHIMKAAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgctgtctcagttggagagatccatgcagtccctgatcacggtgttccatcgctatgcc gacaaggacggtgactgtaacacactgagcaagaaggagctgaaagaactcatgcagaca gaactgggcagcttcctgaagtcccagaaggacccagcagccatagacaagatcatgaag aatctggaccagaatggtgatgggatggtaaacttcgaggagtttgtctctctggtggtg gacctctccatcgcctgtgaacagatctaccagctccacatcatgaaggctgccgctaag aagtga

DBGET integrated database retrieval system