Salmo salar (Atlantic salmon): 106606379 Help Entry 106606379         CDS       T04363                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04914   Progesterone-mediated oocyte maturation sasa04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106606379    04012 ErbB signaling pathway     106606379    04370 VEGF signaling pathway     106606379    04371 Apelin signaling pathway     106606379    04068 FoxO signaling pathway     106606379    04150 mTOR signaling pathway     106606379  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106606379    04137 Mitophagy - animal     106606379   09143 Cell growth and death    04210 Apoptosis     106606379    04218 Cellular senescence     106606379   09144 Cellular community - eukaryotes    04540 Gap junction     106606379   09142 Cell motility    04810 Regulation of actin cytoskeleton     106606379  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106606379   09152 Endocrine system    04910 Insulin signaling pathway     106606379    04912 GnRH signaling pathway     106606379    04914 Progesterone-mediated oocyte maturation     106606379    04916 Melanogenesis     106606379  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106606379   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sasa04031]     106606379 Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     106606379 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106606379 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin SatRNA_48 AAA_14 Motif Other DBs NCBI-GeneID:  106606379 NCBI-ProteinID:  XP_014058006 UniProt:  A0A1S3S165 LinkDB All DBs Position ssa06:6613557..6618827 Genome browser AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL GSRSVESRQAQELARGYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKST QRRCTIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagcttgttgtggtgggtgctggaggtgttgggaagagtgccttaact atccagctcatccagaatcactttgtggatgaatatgaccccaccatcgaggactcgtac aggaagcaggtggtgattgacggagagacgtgtctgctggacatccttgacactgcaggt caagaggagtacagcgccatgagggaccagtacatgaggacaggggaaggcttcctctgt gtgttcgccatcaacaacatcaagtcctttgaggacgttcacctgtacagagaacagatc aacagggtgaaggacagtgacagtgtgcctatggtgctggtggggaacaagagtgacctg gggagtcggagcgtggagagcaggcaggctcaggagctggcccgcggctatggtgtgccc ttcgtggagacctctgccaaaaccagacagggagtggaggaggcgttctactctctagtc agggagatcaggaggtataaggaaaccaaccgcagcaacaagaagagcaagaaaagcact cagagacgttgcaccattctataa

DBGET integrated database retrieval system