Salmo salar (Atlantic salmon): 106607048 Help Entry 106607048         CDS       T04363                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04060   Cytokine-cytokine receptor interaction sasa04218   Cellular senescence sasa04620   Toll-like receptor signaling pathway sasa04621   NOD-like receptor signaling pathway sasa04622   RIG-I-like receptor signaling pathway sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106607048  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     106607048  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     106607048    04621 NOD-like receptor signaling pathway     106607048    04622 RIG-I-like receptor signaling pathway     106607048  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106607048  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     106607048    00536 Glycosaminoglycan binding proteins [BR:sasa00536]     106607048 Cytokines and neuropeptides [BR:sasa04052]  Cytokines   Chemokines    106607048 Glycosaminoglycan binding proteins [BR:sasa00536]  Heparan sulfate / Heparin   Chemokines    106607048 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  106607048 NCBI-ProteinID:  XP_014059084 UniProt:  A0A1S3S4A9 LinkDB All DBs Position ssa06:29743449..29745235 Genome browser AA seq 97 aa AA seqDB search MSIRMSASLVIVLLALLTITEGMSLRGVGADLRCRCIETESRRIGRLIKKVEMFPPSSHC RDTEIIATLSNSGQEICLDVSAPWVKRVIEKMLANNK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagaatgtcagccagccttgtcattgtgctcctggccctcctgaccattact gaggggatgagtctgagaggcgtgggggctgacctgcgatgtcgctgcattgagacggaa agcagacgaattggtagactcattaagaaggtggagatgttccctcccagctcgcactgc agagacactgagatcattgcaactctgagcaacagcggtcaggagatttgtctggatgtc agcgctccttgggtcaagagggtcattgagaagatgctggccaacaacaaatga

DBGET integrated database retrieval system