Salmo salar (Atlantic salmon): 106608015 Help Entry 106608015         CDS       T04363                                  Symbol dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04814   Motor proteins sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     106608015 (dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106608015 (dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sasa03037]     106608015 (dynlt1)    04812 Cytoskeleton proteins [BR:sasa04812]     106608015 (dynlt1) Cilium and associated proteins [BR:sasa03037]  Motile cilia and associated proteins   Dynein arm    106608015 (dynlt1) Cytoskeleton proteins [BR:sasa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      106608015 (dynlt1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  106608015 NCBI-ProteinID:  XP_014061118 UniProt:  A0A1S3S9U5 LinkDB All DBs Position ssa06:67204235..67205865 Genome browser AA seq 113 aa AA seqDB search MDEFQTGEETAFVVDEVSTIIKESVEGAIGGNAYQHSRVNQWTTNVVEQSLSQLSKLGKP FKYIVTCVIMQKNGAGLQTASSCFWDNTTDGSCTVRWENKSMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggatgagtttcagactggagaagagactgcctttgtcgttgacgaagtgagcactatc atcaaagagtcagtagaaggagccataggaggaaatgcctatcaacatagcagagtgaac caatggaccaccaatgtagtggagcagtccctgagtcaacttagcaaactgggcaagcct ttcaagtacattgtgacctgtgttatcatgcagaagaatggggcaggtctacagacagcc agctcgtgcttctgggataacaccactgatggaagctgtacagtgaggtgggagaataaa tccatgtactgcatcgtcagtgtcttcggcctggccatctga

DBGET integrated database retrieval system