Salmo salar (Atlantic salmon): 106611529 Help Entry 106611529         CDS       T04363                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04080   Neuroactive ligand-receptor interaction sasa04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     106611529 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     106611529 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sasa04052]     106611529 (apln) Cytokines and neuropeptides [BR:sasa04052]  Neuropeptides   GPCR binding    106611529 (apln) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  106611529 NCBI-ProteinID:  XP_014067295 UniProt:  A0A1S3SSH3 LinkDB All DBs Position ssa09:complement(51909770..51941596) Genome browser AA seq 78 aa AA seqDB search MNVKILTLVIVLLVSLLCSASAGPIMASTEHGKALEEAGAVRRLVQQNPGRGGQSHRPAG WKRRRPRPRLSHKGPMPF NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc agtgctggtcccatcatggcctccacggagcatggcaaagcactagaagaggcgggcgcc gtgagaaggctggtccagcagaaccccggcaggggtggccagagccacagaccggccggc tggaagaggagacgcccacgaccccgtctctcccataaggggcccatgccattctag

DBGET integrated database retrieval system