Salmo salar (Atlantic salmon): 106612821 Help Entry 106612821         CDS       T04363                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa03272   Virion - Hepatitis viruses sasa04382   Cornified envelope formation sasa04514   Cell adhesion molecules sasa04530   Tight junction Brite KEGG Orthology (KO) [BR:sasa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     106612821  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     106612821  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     106612821  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     106612821  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sasa03037]     106612821    04147 Exosome [BR:sasa04147]     106612821    04515 Cell adhesion molecules [BR:sasa04515]     106612821 Cilium and associated proteins [BR:sasa03037]  Other cilia and associated proteins   Stereociliary proteins    106612821 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    106612821   Exosomal proteins of colorectal cancer cells    106612821 Cell adhesion molecules [BR:sasa04515]  Immunoglobulin superfamily   L1 family    106612821 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  106612821 NCBI-ProteinID:  XP_014069821 UniProt:  A0A1S3SZQ0 LinkDB All DBs Position ssa09:112784889..112785349 Genome browser AA seq 117 aa AA seqDB search MVSQGIQIMGKVMLLISCLTLIIVCALPMWKVTAFIGANIVTAQTIWEGMWMICVVQTTG QTQCKVYDSILALPQDLQAARAMIIISILTSIVGICLSITGGKCTNCTTEEGSQRQQ NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggtttcccaggggatccagatcatgggaaaagtaatgttgttgatcagctgtttgacg ctcatcatcgtgtgtgccctgcctatgtggaaggtcacagccttcatcggagccaacatt gtcacagcacaaaccatctgggagggaatgtggatgatctgtgtggtgcagaccacgggc cagacgcagtgtaaggtctacgactccattctggcactaccccaggacctccaggccgcc agagccatgatcatcatctccatcctgaccagtatcgtcggcatctgcctgtcgatcact ggagggaaatgcaccaactgcacaacagaggagggatctcaacgtcaacagtga

DBGET integrated database retrieval system