Streptomyces calvus: CD934_02545 Help Entry CD934_02545       CDS       T06819                                  Name (GenBank) translocase   KO K03116   sec-independent protein translocase protein TatA Organism sast  Streptomyces calvus Pathway sast03060   Protein export sast03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sast00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CD934_02545  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CD934_02545  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sast02044]     CD934_02545 Secretion system [BR:sast02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CD934_02545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  QDI67666 UniProt:  A0A514JJZ4 LinkDB All DBs Position 649728..650027 Genome browser AA seq 99 aa AA seqDB search MFGLSELAVVLIVVIAVLVAKKGPELARSAGKSARILKAEARAMKEESEATADTSPRIVR GETAAPAADGNAPGAQGPLGSATERTERSAGTPPQDPRP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgttcggactgagcgaactcgccgtcgtcctcatcgtcgtcatcgccgtcctcgtcgcc aagaaaggcccggaactggcccgttccgcaggcaagtcggcccgcatcctcaaggccgag gcgcgcgccatgaaggaggagagcgaggcgacggcggacacctccccgcggatcgtccgc ggcgagaccgccgcaccggccgccgacggcaacgccccgggtgcgcaaggaccgttgggt tccgccaccgaacggaccgagcgctcggcgggcacacctccgcaggaccccaggccgtag

DBGET integrated database retrieval system