Streptomyces calvus: CD934_12115 Help Entry CD934_12115       CDS       T06819                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism sast  Streptomyces calvus Pathway sast00074   Mycolic acid biosynthesis sast00280   Valine, leucine and isoleucine degradation sast00630   Glyoxylate and dicarboxylate metabolism sast00640   Propanoate metabolism sast01100   Metabolic pathways sast01110   Biosynthesis of secondary metabolites sast01120   Microbial metabolism in diverse environments sast01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:sast00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     CD934_12115    00640 Propanoate metabolism     CD934_12115   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     CD934_12115   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CD934_12115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  QDI69361 UniProt:  A0A514JPU5 LinkDB All DBs Position 2948378..2948584 Genome browser AA seq 68 aa AA seqDB search MIKVVRGNPTPEELAAALAVVRARAAAASAVPSGAPAPRDAWSDPSRIAAHRLPQPGPAS WSRTYWPG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgatcaaggtcgtaaggggcaacccgaccccggaggagctggccgccgcactggcggtg gttcgcgcacgcgccgcggcggcgtccgccgtgccgtccggcgcgcccgctccccgtgac gcctggtccgacccgtcccgcatcgccgcccaccgcctgccccagccggggccggcgtcc tggagccgcacgtactggccgggctga

DBGET integrated database retrieval system