Streptomyces calvus: CD934_23280 Help Entry CD934_23280       CDS       T06819                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sast  Streptomyces calvus Pathway sast00998   Biosynthesis of various antibiotics sast01100   Metabolic pathways sast01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sast00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CD934_23280    00074 Mycolic acid biosynthesis     CD934_23280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CD934_23280 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QDI71278 UniProt:  A0A514JXK8 LinkDB All DBs Position complement(5418330..5418578) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgcggagatcgtgaacgagatcgcc ggcatcccggttgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system