Syntrophus aciditrophicus: SYN_02364 Help Entry SYN_02364         CDS       T00346                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sat  Syntrophus aciditrophicus Pathway sat01100   Metabolic pathways sat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SYN_02364    00074 Mycolic acid biosynthesis     SYN_02364   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SYN_02364 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ABC76068 UniProt:  Q2LQM3 LinkDB All DBs Position complement(198947..199189) Genome browser AA seq 80 aa AA seqDB search MTLEEKIIEIIVDQLEVTAEECVPEASFINDLGADSLDLAELLLEMEDTFDVEISTEDLK KIRKIQDVIDYLKVRNVTWD NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtgacgctggaagaaaaaatcatagaaatcattgtcgaccaactggaagtcacagccgag gaatgtgtaccggaggcatccttcatcaatgatctcggagcggattctcttgatctggcg gaactgctgctggaaatggaagacaccttcgatgtggagatttccaccgaagatctcaag aaaatccgcaagattcaggatgtgattgattatctgaaagttcgtaatgtgacttgggat tag

DBGET integrated database retrieval system